PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015890587.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 268aa    MW: 29727.3 Da    PI: 8.6299
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015890587.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1261.1e-3990150262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  XP_015890587.1  90 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 150
                     7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027016.3E-3492148IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-2793148IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52594148IPR003851Zinc finger, Dof-type
PROSITE patternPS01361096132IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MYILFHMGVL IFQPRQERLT SPPAICLFIP CFNDSFERER KMLGNCDEKM VVISSTNEWP  60
QNHIDDQKAL MAETAARTME KPGQEQLQQQ QQALKCPRCD SSNTKFCYYN NYSLSQPRHF  120
CKACKRYWTR GGTLRNVPVG GGCRKNKRVK RPASAIDGVS SSSSSSAPSS NLNQTSQPQI  180
DLSATSNHIS NLFYGLNNNP SDMSLPFPRF NTSGVSNVDT VSGYDLQPQL NSLGLGFSSG  240
IISNGVGGDS DYRNGFNPTK QIQDIVTS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015890587.10.0PREDICTED: dof zinc finger protein DOF1.4, partial
RefseqXP_015890946.10.0PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLF6HM251e-111F6HM25_VITVI; Putative uncharacterized protein
STRINGVIT_10s0003g00040.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.23e-37Dof family protein